PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010532300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 328aa    MW: 36459.5 Da    PI: 5.6569
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010532300.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.22.4e-1065105345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE++l+++ ++  G++ W +Ia+ ++ g+t++++k +w 
   XP_010532300.1  65 SFTPEEEDLIIRMHAAIGSR-WPLIAQQLQ-GKTENDVKMFWK 105
                      79******************.*********.**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.96852IPR017877Myb-like domain
SMARTSM0071725858IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-71065IPR009057Homeodomain-like
SuperFamilySSF466892.44E-1442115IPR009057Homeodomain-like
PROSITE profilePS5129416.14758112IPR017930Myb domain
SMARTSM007172.6E-1062110IPR001005SANT/Myb domain
PfamPF002497.7E-1065106IPR001005SANT/Myb domain
CDDcd001671.63E-765108No hitNo description
Gene3DG3DSA:1.10.10.602.5E-1666112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MVKPSFGRNG SWSDEDDAKT LAPASKHVPR NSVATSKKTG IRRCGKSCRL RWADNCASTS  60
LKHESFTPEE EDLIIRMHAA IGSRWPLIAQ QLQGKTENDV KMFWKSKLKK KLTEMGIDPV  120
THRPFSHILA DYGNINGETL TPNPSARSGS LSRNLRHPLS FSRSEKDSDP NQVGEPGDLL  180
SHLEAIKFMT VAASAQVKPE TFLPDFYNGP QVLLSSSALS DSFSSSSSTA STSSATPQEN  240
TDLNFSWSDF LLDQEIFPEN HQKPEELDNS FAYFSEAVTV TTSTASESNE TKQKKDENPS  300
NGFVESIIAK EKEMYLGFPS YYEQPLYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-14101125105C-Myb DNA-Binding Domain
1msf_C9e-14101125105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00148DAPTransfer from AT1G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010532300.10.0PREDICTED: transcription factor MYB29
TrEMBLV4KB206e-95V4KB20_EUTSA; Uncharacterized protein
STRINGAT1G18960.12e-87(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148221518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18960.11e-78MYB_related family protein